Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Car b 1 isoform 2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Car b I.

Reactivity

Carpinus betulus

Type

Protein

Source

E.coli

Sequence

GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSEGSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

21.4 kDa

Protein Length

Recombinant

Host or Source

Carpinus betulus

Protein Name

Major pollen allergen Car b 1 isoform 2

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Fibroblast Growth Factor 8 (FGF8, FGF-8, Androgen-induced Growth Factor, AIGF, Heparin-binding Growth Factor 8, HBGF-8) (Biotin)
126817-Biotin 100 µL

Fibroblast Growth Factor 8 (FGF8, FGF-8, Androgen-induced Growth Factor, AIGF, Heparin-binding Growth Factor 8, HBGF-8) (Biotin)

Ask
View Details
MMP25, CT (Matrix Metalloproteinase-25, MMP-25, Membrane-type Matrix Metalloproteinase 6, MT-MMP 6, MTMMP6, Membrane-type-6 Matrix Metalloproteinase, MT6-MMP, MT6MMP, Leukolysin, MMP20, MMPL1, MT6MMP) (FITC) discontinued
M2438-10A-FITC 200 µL

MMP25, CT (Matrix Metalloproteinase-25, MMP-25, Membrane-type Matrix Metalloproteinase 6, MT-MMP 6, MTMMP6, Membrane-type-6 Matrix Metalloproteinase, MT6-MMP, MT6MMP, Leukolysin, MMP20, MMPL1, MT6MMP) (FITC) discontinued

Ask
View Details
Horse Phosphatase and Actin Regulator 1 ELISA Kit
MBS042556-01 48 Well

Horse Phosphatase and Actin Regulator 1 ELISA Kit

Ask
View Details
Horse Phosphatase and Actin Regulator 1 ELISA Kit
MBS042556-02 96 Well

Horse Phosphatase and Actin Regulator 1 ELISA Kit

Ask
View Details
Horse Phosphatase and Actin Regulator 1 ELISA Kit
MBS042556-03 5x 96 Well

Horse Phosphatase and Actin Regulator 1 ELISA Kit

Ask
View Details
Horse Phosphatase and Actin Regulator 1 ELISA Kit
MBS042556-04 10x 96 Well

Horse Phosphatase and Actin Regulator 1 ELISA Kit

Ask
View Details