What is the catalog number for Car b 1 isoform 2 Recombinant Protein?

The catalog number for Car b 1 isoform 2 Recombinant Protein is OPCA02066-100UG.

What sizes are available for Car b 1 isoform 2 Recombinant Protein?

Car b 1 isoform 2 Recombinant Protein is available in the following size(s): 100 µg.

Is Car b 1 isoform 2 Recombinant Protein in stock?

Car b 1 isoform 2 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Car b 1 isoform 2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Car b I.

Reactivity

Carpinus betulus

Type

Protein

Source

E.coli

Sequence

GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSEGSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.