Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPDK Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Pyruvate, orthophosphate dikinase.

Reactivity

Entamoeba histolytica

Target

Catalyzes the reversible phosphorylation of pyruvate and phosphate. In E.histolytica and C.symbiosus, PPDK functions in the direction of ATP synthesis.

Type

Protein

Source

E.coli

Sequence

MQRVYAFEDGDGTNKKLLGGKGAGLCTMTKIGLPVPQGFVITTEMCKQFIANGNKMPEGLMEEVKKEYQLVEKKSGKVFGGEENPLLVSVRSGAAMSMPGMMDTILNLGLNDKTVVALAKLTNNERFAYDSYRRFVSLFGKIALNACDEVYDKTLENKKVEKGVKLDTELDANDMKELAQVFIKKTEEFTKQPFPVDPYAQLEFAICAVFRSWMGKRAVDYRREFKITPEQADGTAVSVVSMVYGNMGNDSATGVCFTRDPGTGENMFFGEYLKNAQGEDVVAGIRTPQIISKMAEDRDLPGCYEQLLDIRKKLEGYFHEVQDFEFTIERKKLYMLQTRNGK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

54.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PPDK

Host or Source

Entamoeba histolytica

Protein Name

Pyruvate, phosphate dikinase

Gene Name URL

PPDK

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD355 Mouse mAb
63372 100 µL

CD355 Mouse mAb

Sign In for Pricing
View Details
UBXN7 (NM_015562) Human Over-expression Lysate
LC414475 20 µg

UBXN7 (NM_015562) Human Over-expression Lysate

Sign In for Pricing
View Details
Trim40 siRNA Oligos set (Rat)
47783176 3x 5 nmol

Trim40 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Human ASH2L qPCR Primer Pair
QH27701S 200 Tests

Human ASH2L qPCR Primer Pair

Sign In for Pricing
View Details
Trehalose 6-behenate
HY-101871 1 Each

Trehalose 6-behenate

Sign In for Pricing
View Details
Aquaporin 3, Gill Blood Group (AQP3) BioAssayTM ELISA Kit (Rat)
517016 96 Tests

Aquaporin 3, Gill Blood Group (AQP3) BioAssayTM ELISA Kit (Rat)

Sign In for Pricing
View Details