Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPDK Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Pyruvate, orthophosphate dikinase.

Reactivity

Entamoeba histolytica

Target

Catalyzes the reversible phosphorylation of pyruvate and phosphate. In E.histolytica and C.symbiosus, PPDK functions in the direction of ATP synthesis.

Type

Protein

Source

E.coli

Sequence

MQRVYAFEDGDGTNKKLLGGKGAGLCTMTKIGLPVPQGFVITTEMCKQFIANGNKMPEGLMEEVKKEYQLVEKKSGKVFGGEENPLLVSVRSGAAMSMPGMMDTILNLGLNDKTVVALAKLTNNERFAYDSYRRFVSLFGKIALNACDEVYDKTLENKKVEKGVKLDTELDANDMKELAQVFIKKTEEFTKQPFPVDPYAQLEFAICAVFRSWMGKRAVDYRREFKITPEQADGTAVSVVSMVYGNMGNDSATGVCFTRDPGTGENMFFGEYLKNAQGEDVVAGIRTPQIISKMAEDRDLPGCYEQLLDIRKKLEGYFHEVQDFEFTIERKKLYMLQTRNGK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

54.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PPDK

Host or Source

Entamoeba histolytica

Protein Name

Pyruvate, phosphate dikinase

Gene Name URL

PPDK

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nkx3-1 Peptide - middle region (AAP37115)
AAP37115-100UG 100 µg

Nkx3-1 Peptide - middle region (AAP37115)

Sign In for Pricing
View Details
Mcoln3 (NM_134160) Mouse Tagged ORF Clone
MR225394 10 µg

Mcoln3 (NM_134160) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TRNAK7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2496208 1.0 µg DNA

TRNAK7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
RGD1310553 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7241705 3x 1.0 µg

RGD1310553 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Human Lymphotoxin β R/LTBR/TNFRSF3/TNFRrp (C-Fc)
orb1648799-01 10 µg

Recombinant Human Lymphotoxin β R/LTBR/TNFRSF3/TNFRrp (C-Fc)

Sign In for Pricing
View Details
Recombinant Human Lymphotoxin β R/LTBR/TNFRSF3/TNFRrp (C-Fc)
orb1648799-02 50 µg

Recombinant Human Lymphotoxin β R/LTBR/TNFRSF3/TNFRrp (C-Fc)

Sign In for Pricing
View Details