Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPDK Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Pyruvate, orthophosphate dikinase.

Reactivity

Entamoeba histolytica

Target

Catalyzes the reversible phosphorylation of pyruvate and phosphate. In E.histolytica and C.symbiosus, PPDK functions in the direction of ATP synthesis.

Type

Protein

Source

E.coli

Sequence

MQRVYAFEDGDGTNKKLLGGKGAGLCTMTKIGLPVPQGFVITTEMCKQFIANGNKMPEGLMEEVKKEYQLVEKKSGKVFGGEENPLLVSVRSGAAMSMPGMMDTILNLGLNDKTVVALAKLTNNERFAYDSYRRFVSLFGKIALNACDEVYDKTLENKKVEKGVKLDTELDANDMKELAQVFIKKTEEFTKQPFPVDPYAQLEFAICAVFRSWMGKRAVDYRREFKITPEQADGTAVSVVSMVYGNMGNDSATGVCFTRDPGTGENMFFGEYLKNAQGEDVVAGIRTPQIISKMAEDRDLPGCYEQLLDIRKKLEGYFHEVQDFEFTIERKKLYMLQTRNGK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

54.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PPDK

Host or Source

Entamoeba histolytica

Protein Name

Pyruvate, phosphate dikinase

Gene Name URL

PPDK

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFM/Afamin Rabbit anti-Human Polyclonal (aa22-210) Antibody
MBS2402219-01 0.05 mL

AFM/Afamin Rabbit anti-Human Polyclonal (aa22-210) Antibody

Sign In for Pricing
View Details
AFM/Afamin Rabbit anti-Human Polyclonal (aa22-210) Antibody
MBS2402219-02 5x 0.05 mL

AFM/Afamin Rabbit anti-Human Polyclonal (aa22-210) Antibody

Sign In for Pricing
View Details
Rabbit Anti-FLT3 Polyclonal Antibody
PAV7299 100 μL

Rabbit Anti-FLT3 Polyclonal Antibody

Sign In for Pricing
View Details
NT5C2 Double Nickase Plasmid (m)
sc-429467-NIC 20 µg

NT5C2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Olr640 siRNA Oligos set (Rat)
34561176 3x 5 nmol

Olr640 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
MZF-1 shRNA Plasmid (h)
sc-45714-SH 20 µg

MZF-1 shRNA Plasmid (h)

Sign In for Pricing
View Details