Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E6 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

E6, Protein E6

Reactivity

Human papillomavirus type 52|Human Papillomavirus Type 52

Target

Plays a major role in the induction and maintenance of cellular transformation. Acts mainly as an oncoprotein by stimulating the destruction of many host cell key regulatory proteins. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase, and inactivates tumor suppressors TP53 and TP73 by targeting them to the 26S proteasome for degradation. In turn, DNA damage and chromosomal instabilities increase and lead to cell proliferation and cancer development. The complex E6/E6AP targets several other substrates to degradation via the proteasome including host DLG1 or NFX1, a repressor of human telomerase reverse transcriptase (hTERT) . The resulting increased expression of hTERT prevents the shortening of telomere length leading to cell immortalization. Other cellular targets including BAK1, Fas-associated death domain-containing protein (FADD) and procaspase 8, are degraded by E6/E6AP causing inhibition of apoptosis. E6 also inhibits immune response by interacting with host IRF3 and TYK2. These interactions prevent IRF3 transcriptional activities and inhibit TYK2-mediated JAK-STAT activation by interferon alpha resulting in inhibition of the interferon signaling pathway.

Type

Protein

Source

E.coli

Sequence

MFEDPATRPRTLHELCEVLEESVHEIRLQCVQCKKELQRREVYKFLFTDLRIVYRDNNPYGVCIMCLRFLSKISEYRHYQYSLYGKTLEERVKKPLSEITIRCIICQTPLCPEEKERHVNANKRFHNIMGRWTGRCSECWRPRPVTQV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

E6

Host or Source

Human papillomavirus type 52

Protein Name

Protein E6

Gene Name URL

E6

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Linker For Activation Of T-Cell (LAT) ELISA Kit
MBS269720-01 48 Well

Human Linker For Activation Of T-Cell (LAT) ELISA Kit

Ask
View Details
Human Linker For Activation Of T-Cell (LAT) ELISA Kit
MBS269720-02 96 Well

Human Linker For Activation Of T-Cell (LAT) ELISA Kit

Ask
View Details
Human Linker For Activation Of T-Cell (LAT) ELISA Kit
MBS269720-03 5x 96 Well

Human Linker For Activation Of T-Cell (LAT) ELISA Kit

Ask
View Details
Human Linker For Activation Of T-Cell (LAT) ELISA Kit
MBS269720-04 10x 96 Well

Human Linker For Activation Of T-Cell (LAT) ELISA Kit

Ask
View Details
Human TRIM22 (E3 ubiquitin-protein ligase TRIM22) ELISA Kit
EH2304 96 Tests

Human TRIM22 (E3 ubiquitin-protein ligase TRIM22) ELISA Kit

Ask
View Details
Human Protein FAM189A2 (FAM189A2) ELISA Kit
abx522937 96 Tests

Human Protein FAM189A2 (FAM189A2) ELISA Kit

Ask
View Details