What is the catalog number for PhyA Recombinant Protein?

The catalog number for PhyA Recombinant Protein is OPCA02057-20UG.

What sizes are available for PhyA Recombinant Protein?

PhyA Recombinant Protein is available in the following size(s): 20 µg.

Is PhyA Recombinant Protein in stock?

PhyA Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

PhyA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

3 phytase A; Myo-inositol hexakisphosphate phosphohydrolase A; Myo-inositol-hexaphosphate 3-phosphohydrolase A.

Reactivity

Aspergillus niger

Target

Catalyzes the hydrolysis of inorganic orthophosphate from phytate.

Type

Protein

Source

E.coli

Sequence

ASRNQSSCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.