Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PhyA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

3 phytase A; Myo-inositol hexakisphosphate phosphohydrolase A; Myo-inositol-hexaphosphate 3-phosphohydrolase A.

Reactivity

Aspergillus niger

Target

Catalyzes the hydrolysis of inorganic orthophosphate from phytate.

Type

Protein

Source

E.coli

Sequence

ASRNQSSCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

64.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PHYA

Host or Source

Aspergillus niger

Protein Name

3-phytase A

Gene Name URL

PHYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARH2 Double Nickase Plasmid (h2)
sc-410510-NIC-2 20 µg

ARH2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Anti-Melanoma gp100/Pmel Picoband® Antibody-FITC Conjugate
A01262-2-FITC 100 µg/Vial

Anti-Melanoma gp100/Pmel Picoband® Antibody-FITC Conjugate

Sign In for Pricing
View Details
Bun107 Antibody
orb853627 2 mg

Bun107 Antibody

Sign In for Pricing
View Details
C1orf97 CRISPR Knock Out 293T Cell Line (Human)
14238141 1x 10^6 Cells / 1.0 mL

C1orf97 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Aflatoxins B1+B2+G1+G2 (Mouse monoclonal)
MBS355773-01 1 mg

Aflatoxins B1+B2+G1+G2 (Mouse monoclonal)

Sign In for Pricing
View Details
Aflatoxins B1+B2+G1+G2 (Mouse monoclonal)
MBS355773-02 5x 1 mg

Aflatoxins B1+B2+G1+G2 (Mouse monoclonal)

Sign In for Pricing
View Details