Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSP1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Ran GTPase GSP1

Gene Aliases

Chromosome stability protein 17; CNR1; CST17; Genetic suppressor of PRP20-1; GTPase Ran homolog; Ran GTPase GSP1; YLR293C.

Gene ID

851000

Accession Number

NP_013396.1

Reactivity

Saccharomyces cerevisiae

Target

GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Essential for cell viability. By analogy with Ras, Ran may be activated when GTP is exchanged for bound GDP by RCC1 and inactivated when GTP is hydrolyzed by Ran upon activation by RanGAP1.

Type

Protein

Source

E.coli

Sequence

SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GSP1

Host or Source

Yeast

Protein Name

GTP-binding nuclear protein GSP1/CNR1

Gene Name URL

GSP1

Nucleotide Accession Number

NM_001182181.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Potassium voltage-gated channel subfamily C member 2 (KCNC2) ELISA Kit
abx529599 96 Tests

Human Potassium voltage-gated channel subfamily C member 2 (KCNC2) ELISA Kit

Sign In for Pricing
View Details
NFAT1 (D43B1) XP® Rabbit Monoclonal Antibody
CST 5861T 20 µL

NFAT1 (D43B1) XP® Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Akt3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4445606 1.0 µg DNA

Akt3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
IP-10 Human Recombinant (CXCL10) (IP 10 Human)
PT_41304-01 5 µg

IP-10 Human Recombinant (CXCL10) (IP 10 Human)

Sign In for Pricing
View Details
IP-10 Human Recombinant (CXCL10) (IP 10 Human)
PT_41304-02 25 µg

IP-10 Human Recombinant (CXCL10) (IP 10 Human)

Sign In for Pricing
View Details
IP-10 Human Recombinant (CXCL10) (IP 10 Human)
PT_41304-03 1 mg

IP-10 Human Recombinant (CXCL10) (IP 10 Human)

Sign In for Pricing
View Details