Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

E2; Peplomer protein.

Reactivity

Bovine Coronavirus

Target

Spike protein S1: attaches the virion to the cell membrane by interacting with host receptor, initiating the infection.

Type

Protein

Source

E.coli

Sequence

PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIEAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTAASCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPIT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

S

Host or Source

Bovine

Protein Name

Spike glycoprotein

Gene Name URL

S

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFC2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
38852066 1.0 µg DNA

RFC2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Hamster Interleukin 2 Antibody (Anti-IL2) ELISA Kit
MBS9392367-01 48 Well

Hamster Interleukin 2 Antibody (Anti-IL2) ELISA Kit

Sign In for Pricing
View Details
Hamster Interleukin 2 Antibody (Anti-IL2) ELISA Kit
MBS9392367-02 96 Well

Hamster Interleukin 2 Antibody (Anti-IL2) ELISA Kit

Sign In for Pricing
View Details
Hamster Interleukin 2 Antibody (Anti-IL2) ELISA Kit
MBS9392367-03 5x 96 Well

Hamster Interleukin 2 Antibody (Anti-IL2) ELISA Kit

Sign In for Pricing
View Details
Hamster Interleukin 2 Antibody (Anti-IL2) ELISA Kit
MBS9392367-04 10x 96 Well

Hamster Interleukin 2 Antibody (Anti-IL2) ELISA Kit

Sign In for Pricing
View Details
Phospho-LIM Kinase 2 (Thr505) Rabbit pAb
E47R18257 100 µL

Phospho-LIM Kinase 2 (Thr505) Rabbit pAb

Sign In for Pricing
View Details