Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UbcD6 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Ubiquitin conjugating enzyme 6

Gene Aliases

BcDNA:RE56673; CG2013; CG2013-PA; CG2013-PC; Dhr6; Dmel\CG2013; Dmel_CG2013; dRAD6; E2 ubiquitin-conjugating enzyme 6; RAD6; Rad6a; UBC6; Ubc6-PA; Ubc6-PC; UbcD6; Ubiquitin carrier protein; ubiquitin conjugating enzyme; ubiquitin conjugating enzyme 6; Ubiquitin-protein ligase.

Gene ID

40610

Accession Number

NP_001246916.1

Reactivity

Drosophila melanogaster

Target

Catalyzes the covalent attachment of ubiquitin to other proteins. Required for postreplication repair of UV-damaged DNA (PubMed:1902572) . Involved in the negative regulation of the Ras/MAPK signaling pathway in the wing by acting with the putative E3 ligases poe, Kcmf1 and Ufd4 to mediate the ubiquitination and proteasomal degradation of rl/MAPK (PubMed:27552662) .

Type

Protein

Source

E.coli

Sequence

MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Ubc6

Host or Source

Drosophila melanogaster

Protein Name

Ubiquitin-conjugating enzyme E2-17 kDa

Gene Name URL

Ubc6

Nucleotide Accession Number

NM_001259987.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Entadamide-A-β-D-glucopyranoside
TBW01034 20mg

Entadamide-A-β-D-glucopyranoside

Sign In for Pricing
View Details
Bovine Complement Fragment 5A C5a ELISA Kit
BG-BVN10647 1 Each

Bovine Complement Fragment 5A C5a ELISA Kit

Sign In for Pricing
View Details
Cathepsin D, Fluorometric 390, BioAssayTM Kit (CatD, CLN10, CPSD, CTSD, Lysosomal aspartyl peptidase, MGC2311) discontinued
C2097-33 1 Kit

Cathepsin D, Fluorometric 390, BioAssayTM Kit (CatD, CLN10, CPSD, CTSD, Lysosomal aspartyl peptidase, MGC2311) discontinued

Sign In for Pricing
View Details
PSMC6 Antibody, FITC conjugated
A32292-100UG 100 µg

PSMC6 Antibody, FITC conjugated

Sign In for Pricing
View Details
PRMT5, CT (Protein Methyltransferase JBP1, Protein Arginine N-methyltransferase 5, Histone-arginine N-methyltransferase PRMT5, Shk1 Kinase-binding Protein 1 Homolog, SKB1 Homolog, SKB1Hs, Jak-binding Protein 1, 72kD ICln-Binding Protein, HRMT1L5, IBP72, JBP1, SKB1) (MaxLight 650) discontinued
P9004-25B-ML650 100 µL

PRMT5, CT (Protein Methyltransferase JBP1, Protein Arginine N-methyltransferase 5, Histone-arginine N-methyltransferase PRMT5, Shk1 Kinase-binding Protein 1 Homolog, SKB1 Homolog, SKB1Hs, Jak-binding Protein 1, 72kD ICln-Binding Protein, HRMT1L5, IBP72, JBP1, SKB1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
BAY-1251152 2mg
A17029-2 2 mg

BAY-1251152 2mg

Sign In for Pricing
View Details