Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UbcD6 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Ubiquitin conjugating enzyme 6

Gene Aliases

BcDNA:RE56673; CG2013; CG2013-PA; CG2013-PC; Dhr6; Dmel\CG2013; Dmel_CG2013; dRAD6; E2 ubiquitin-conjugating enzyme 6; RAD6; Rad6a; UBC6; Ubc6-PA; Ubc6-PC; UbcD6; Ubiquitin carrier protein; ubiquitin conjugating enzyme; ubiquitin conjugating enzyme 6; Ubiquitin-protein ligase.

Gene ID

40610

Accession Number

NP_001246916.1

Reactivity

Drosophila melanogaster

Target

Catalyzes the covalent attachment of ubiquitin to other proteins. Required for postreplication repair of UV-damaged DNA (PubMed:1902572) . Involved in the negative regulation of the Ras/MAPK signaling pathway in the wing by acting with the putative E3 ligases poe, Kcmf1 and Ufd4 to mediate the ubiquitination and proteasomal degradation of rl/MAPK (PubMed:27552662) .

Type

Protein

Source

E.coli

Sequence

MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Ubc6

Host or Source

Drosophila melanogaster

Protein Name

Ubiquitin-conjugating enzyme E2-17 kDa

Gene Name URL

Ubc6

Nucleotide Accession Number

NM_001259987.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rps6ka2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4431408 1.0 µg DNA

Rps6ka2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
α-D-Mannopyranose, 3-O- (phenylmethyl) -, 1,2,4,6-tetraacetate
TSW-00393-01 100 mg

α-D-Mannopyranose, 3-O- (phenylmethyl) -, 1,2,4,6-tetraacetate

Sign In for Pricing
View Details
α-D-Mannopyranose, 3-O- (phenylmethyl) -, 1,2,4,6-tetraacetate
TSW-00393-02 250 mg

α-D-Mannopyranose, 3-O- (phenylmethyl) -, 1,2,4,6-tetraacetate

Sign In for Pricing
View Details
α-D-Mannopyranose, 3-O- (phenylmethyl) -, 1,2,4,6-tetraacetate
TSW-00393-03 50 mg

α-D-Mannopyranose, 3-O- (phenylmethyl) -, 1,2,4,6-tetraacetate

Sign In for Pricing
View Details
3-Bromo-2- (N, N-diethylamino) -5-nitropyridine
424125-01 100 mg

3-Bromo-2- (N, N-diethylamino) -5-nitropyridine

Sign In for Pricing
View Details
3-Bromo-2- (N, N-diethylamino) -5-nitropyridine
424125-02 250 mg

3-Bromo-2- (N, N-diethylamino) -5-nitropyridine

Sign In for Pricing
View Details