Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reg3b Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Regenerating family member 3 beta

Gene Aliases

Pancreatitis-associated protein 1; Pap; Pap1; peptide 23; reg III-beta; REG-2; REG-3-beta; regenerating islet-derived 3 beta; regenerating islet-derived protein 3-beta; regenerating islet-derived protein III-beta.

Gene ID

24618

Accession Number

NP_445741.1

Reactivity

Rat|Rattus norvegicus

Target

Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues (By similarity) .

Type

Protein

Source

E.coli

Sequence

EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Reg3b

Host or Source

Rat

Protein Name

Regenerating islet-derived protein 3-beta

Gene Name URL

Reg3b

Nucleotide Accession Number

NM_053289.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Separase, phosphorylated (Ser748) (ESPL1, Separin, Caspase-like Protein ESPL1, Extra Spindle Poles-like 1 Protein, ESP1, KIAA0165) (MaxLight 405) discontinued
S0952-01F-ML405 100 µL

Separase, phosphorylated (Ser748) (ESPL1, Separin, Caspase-like Protein ESPL1, Extra Spindle Poles-like 1 Protein, ESP1, KIAA0165) (MaxLight 405) discontinued

Sign In for Pricing
View Details
CHCHD4 rabbit pAb
RA31592-01 50 µL

CHCHD4 rabbit pAb

Sign In for Pricing
View Details
CHCHD4 rabbit pAb
RA31592-02 100 µL

CHCHD4 rabbit pAb

Sign In for Pricing
View Details
MTCO2P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV734495 1.0 µg DNA

MTCO2P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), 0.2mg/mL
BNUB2166-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), 0.2mg/mL

Sign In for Pricing
View Details
TLL2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV704339 1.0 µg DNA

TLL2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details