Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reg3b Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Regenerating family member 3 beta

Gene Aliases

Pancreatitis-associated protein 1; Pap; Pap1; peptide 23; reg III-beta; REG-2; REG-3-beta; regenerating islet-derived 3 beta; regenerating islet-derived protein 3-beta; regenerating islet-derived protein III-beta.

Gene ID

24618

Accession Number

NP_445741.1

Reactivity

Rat|Rattus norvegicus

Target

Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues (By similarity) .

Type

Protein

Source

E.coli

Sequence

EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Reg3b

Host or Source

Rat

Protein Name

Regenerating islet-derived protein 3-beta

Gene Name URL

Reg3b

Nucleotide Accession Number

NM_053289.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Potassium Acetate Solution 3 M pH 5.2
BU-107 100 mL

Potassium Acetate Solution 3 M pH 5.2

Sign In for Pricing
View Details
Human IL-33
MBS692034-01 0.002 mg

Human IL-33

Sign In for Pricing
View Details
Human IL-33
MBS692034-02 0.01 mg

Human IL-33

Sign In for Pricing
View Details
Human IL-33
MBS692034-03 5x 0.01 mg

Human IL-33

Sign In for Pricing
View Details
Human NADPH oxidase 1 (NOX1) ELISA Kit
SL2427Hu-01 48 Tests

Human NADPH oxidase 1 (NOX1) ELISA Kit

Sign In for Pricing
View Details
Human NADPH oxidase 1 (NOX1) ELISA Kit
SL2427Hu-02 96 Tests

Human NADPH oxidase 1 (NOX1) ELISA Kit

Sign In for Pricing
View Details