What is the catalog number for AroD Recombinant Protein?

The catalog number for AroD Recombinant Protein is OPCA02036-100UG.

What sizes are available for AroD Recombinant Protein?

AroD Recombinant Protein is available in the following size(s): 100 µg.

Is AroD Recombinant Protein in stock?

AroD Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

AroD Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

3-dehydroquinase

Gene Aliases

STY1760; Type I dehydroquinase; Type I DHQase.

Gene ID

1248131

Accession Number

NP_456161.1

Reactivity

Salmonella enterica|Salmonella typhi

Target

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site.

Type

Protein

Source

E.coli

Sequence

MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.