Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Karasurin-C Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

RRNA N-glycosidase.

Reactivity

Trichosanthes kirilowii

Target

Abortion-inducing protein. It inactivates eukaryotic 60S ribosomal subunits.

Type

Protein

Source

E.coli

Sequence

EGDVSFRLSGATSSSYGVFISNLRKALPYERKLYDIPLLRSTLPGSQRYALIHLTNYADETISVAIDVTNVYVMGYRAGDTSYFFNEASATEAAKYVFKDAKRKVTLPYSGNYERLQIAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFETPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.4 kDa

Protein Length

Recombinant

Host or Source

Trichosanthes kirilowii

Protein Name

Ribosome-inactivating protein karasurin-C

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Toll Like Receptor 4 ELISA Kit (TLR4)
MBS9137925-01 96 Tests

Human Toll Like Receptor 4 ELISA Kit (TLR4)

Sign In for Pricing
View Details
Human Toll Like Receptor 4 ELISA Kit (TLR4)
MBS9137925-02 5x 96 Tests

Human Toll Like Receptor 4 ELISA Kit (TLR4)

Sign In for Pricing
View Details
Recombinant Human IL-2 Protein Animal-Free
BT-002-AFL-01M/LQ 1 mg

Recombinant Human IL-2 Protein Animal-Free

Sign In for Pricing
View Details
HTR1F Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV668658 1.0 µg DNA

HTR1F Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
CD79b Monoclonal Antibody
ANT-11325-50ug 50 µg

CD79b Monoclonal Antibody

Sign In for Pricing
View Details
GBP5 (NM_052942) Human Recombinant Protein
TP306627L 1 mg

GBP5 (NM_052942) Human Recombinant Protein

Sign In for Pricing
View Details