Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ice-structuring Lambda OP-3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Antifreeze protein lambda OP-3.

Reactivity

Zoarces americanus

Target

Contributes to protect fish blood from freezing at subzero sea water temperatures. Lowers the blood freezing point. Binds to nascent ice crystals and prevents further growth (By similarity) .

Type

Protein

Source

E.coli

Sequence

NQSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPRLVSMQVNQAVPMGTTLMPDMVKFYCLCAPKN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

11.6 kDa

Protein Length

Recombinant

Host or Source

Zoarces americanus

Protein Name

Ice-structuring protein lambda OP-3

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA G Recombinant Antibody, Cy7 Conjugated
bsm-61409R-Cy7-01 20 µL

HLA G Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
HLA G Recombinant Antibody, Cy7 Conjugated
bsm-61409R-Cy7-02 100 µL

HLA G Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
ERGIC2 Rabbit pAb
MBS8546772-01 0.1 mL

ERGIC2 Rabbit pAb

Sign In for Pricing
View Details
ERGIC2 Rabbit pAb
MBS8546772-02 0.1 mL (AF405L)

ERGIC2 Rabbit pAb

Sign In for Pricing
View Details
ERGIC2 Rabbit pAb
MBS8546772-03 0.1 mL (AF405S)

ERGIC2 Rabbit pAb

Sign In for Pricing
View Details
ERGIC2 Rabbit pAb
MBS8546772-04 0.1 mL (AF610)

ERGIC2 Rabbit pAb

Sign In for Pricing
View Details