Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ice-structuring Lambda OP-3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Antifreeze protein lambda OP-3.

Reactivity

Zoarces americanus

Target

Contributes to protect fish blood from freezing at subzero sea water temperatures. Lowers the blood freezing point. Binds to nascent ice crystals and prevents further growth (By similarity) .

Type

Protein

Source

E.coli

Sequence

NQSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPRLVSMQVNQAVPMGTTLMPDMVKFYCLCAPKN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

11.6 kDa

Protein Length

Recombinant

Host or Source

Zoarces americanus

Protein Name

Ice-structuring protein lambda OP-3

More Discoveries

Explore Other Products

Browse additional items from our catalog

MyD88 Antibody
GWB-91854E 0.1 mg

MyD88 Antibody

Sign In for Pricing
View Details
Human cytokinin MB (CKMB) Elisa Kit
EK700488 96 Well

Human cytokinin MB (CKMB) Elisa Kit

Sign In for Pricing
View Details
Ox-LDL Monoclonal Antibody, PE Conjugated
bsm-1698M-PE 100 µL

Ox-LDL Monoclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
CCR-1/CD191 Rabbit Polyclonal Antibody (Cy5.5)
orb1054730 100 µL

CCR-1/CD191 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Chaperone protein DnaK (dnaK), partial
MBS1160090 Inquire

Recombinant Helicobacter pylori Chaperone protein DnaK (dnaK), partial

Sign In for Pricing
View Details
TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: LBI13H3]
AMM15883VCF 100 µg

TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: LBI13H3]

Sign In for Pricing
View Details