Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vpx Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Vpx protein

Gene Aliases

HIV2gp3; Viral protein X; vpx protein; X ORF protein.

Gene ID

1724714

Accession Number

NP_056840.1

Reactivity

Human Immunodeficiency Virus Type 2

Target

Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.

Type

Protein

Source

E.coli

Sequence

MTDPRERVPPGNSGEETIGEAFEWLERTIEALNREAVNHLPRELIFQVWQRSWRYWHDEQGMSASYTKYRYLCLMQKAIFTHFKRGCTCWGEDMGREGLEDQGPPPPPPPGLV

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for exact concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HIV2gp3

Host or Source

E.coli

Protein Name

Protein Vpx

Gene Name URL

HIV2gp3

Nucleotide Accession Number

NC_001722.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc Finger Protein 713 (ZNF713) Antibody
abx219441-01 50 µg

Zinc Finger Protein 713 (ZNF713) Antibody

Sign In for Pricing
View Details
Zinc Finger Protein 713 (ZNF713) Antibody
abx219441-02 100 µg

Zinc Finger Protein 713 (ZNF713) Antibody

Sign In for Pricing
View Details
Pigeon Growth Differentiation Factor 10 ELISA Kit
MBS065273 Inquire

Pigeon Growth Differentiation Factor 10 ELISA Kit

Sign In for Pricing
View Details
KAKU4 Antibody
A78731-50UL 50 μL

KAKU4 Antibody

Sign In for Pricing
View Details
Anti-IFN-γ (Emapalumab), Human IgG1 Antibody
A2270-100 100 µg

Anti-IFN-γ (Emapalumab), Human IgG1 Antibody

Sign In for Pricing
View Details
Murashige and Skoog (MS) Vitamin Powder Mix
30630198-1 100 mL

Murashige and Skoog (MS) Vitamin Powder Mix

Sign In for Pricing
View Details