What is the catalog number for Klk1b22 Recombinant Protein?

The catalog number for Klk1b22 Recombinant Protein is OPCA02028-20UG.

What sizes are available for Klk1b22 Recombinant Protein?

Klk1b22 Recombinant Protein is available in the following size(s): 20 µg.

Is Klk1b22 Recombinant Protein in stock?

Klk1b22 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

Klk1b22 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Kallikrein 1-related peptidase b22

Gene Aliases

Beta-NGF-endopeptidase; Egfbp; Egfbp-; EGF-BP A; Egfbp1; Egfbp-1; epidermal growth factor-binding protein type A; glandular kallikrein K22; kallikrein 1-related peptidase b22; Klk2; Klk22; mGk-22; nerve growth factor beta chain endopeptidase; tissue kallikrein 22.

Gene ID

13646

Accession Number

NP_034244.1

Reactivity

Mouse|Mus musculus

Target

Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Type

Protein

Source

E.coli

Sequence

ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Klk1b22

Host or Source

Mouse

Protein Name

Kallikrein 1-related peptidase b22

Gene Name URL

Klk1b22

Nucleotide Accession Number

NM_010114.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL

BNC042216-100 1x 100 µL