Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mcpt4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Mast cell protease 4

Gene Aliases

Mast cell protease 4; Mcp; Mcp-; Mcp4; Mcp-4; MMCP-; MMCP-4; MMCP-4A; MMCP-4B; MSMCP; myo; myonase; serosal mast cell protease.

Gene ID

17227

Accession Number

NP_034909.2

Reactivity

Mouse|Mus musculus

Target

Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and Phe residues at the P1 position. Preferentially hydrolyzes the 'Tyr-4-|-Ile-5' bond of angiotensin I and the 'Phe-20-|-Ala-21' bond of amyloid beta-protein, and is less active towards the 'Phe-8-|-His-9' bond of angiotensin I and the 'Phe-4-|-Ala-5' and 'Tyr-10-|-Glu-11' bonds of amyloid beta-protein. Involved in thrombin regulation and fibronectin processing.

Type

Protein

Source

E.coli

Sequence

IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for exact concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Mcpt4

Host or Source

Mouse

Protein Name

Mast cell protease 4

Gene Name URL

Mcpt4

Nucleotide Accession Number

NM_010779.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isocitrate Dehydrogenase, CT (Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial [Precursor], Isocitric dehydrogenase, NAD (+) -specific ICDH, IDH3A, IDH3) (PE) discontinued
I8850-01E-PE 200 µL

Isocitrate Dehydrogenase, CT (Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial [Precursor], Isocitric dehydrogenase, NAD (+) -specific ICDH, IDH3A, IDH3) (PE) discontinued

Sign In for Pricing
View Details
C5a anaphylatoxin Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-0324R-BF405 100 µL

C5a anaphylatoxin Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Precision Balance (BFT-1606)
BFT-1606 1 Unit

Precision Balance (BFT-1606)

Sign In for Pricing
View Details
Dog Cervical Epithelial Cells (CrEC)
abx700183 5x 10^5 Cells

Dog Cervical Epithelial Cells (CrEC)

Sign In for Pricing
View Details
Reagecon 1000 NTU Non Ratio Turbidity Standard
CRS-1000-100 100 mL

Reagecon 1000 NTU Non Ratio Turbidity Standard

Sign In for Pricing
View Details
ELISA kit for Rabbit Tissue inhibitors of metalloproteinase 4 (TIMP4)
KTE90018-01 48 Tests

ELISA kit for Rabbit Tissue inhibitors of metalloproteinase 4 (TIMP4)

Sign In for Pricing
View Details