Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vpx Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Viral protein X; X ORF protein.

Reactivity

Simian immunodeficiency virus|Simian Immunodeficiency Virus

Target

Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.

Type

Protein

Source

E.coli

Sequence

MSDPRERIPPGNSGEETIGEAFDWLDRTVEEINRAAVNHLPRELIFQVWRRSWEYWHDEMGMSVSYTKYRYLCLIQKAMFMHCKKGCRCLGGEHGAGGWRPGPPPPPPPGLA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

VPX

Host or Source

Monkey

Protein Name

Protein Vpx

Gene Name URL

VPX

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Follistatin,FS ELISA Kit
CN-03911H2 48T

Human Follistatin,FS ELISA Kit

Sign In for Pricing
View Details
Human Carp Antibody ELISA Kit
MBS3801897-01 48 Well

Human Carp Antibody ELISA Kit

Sign In for Pricing
View Details
Human Carp Antibody ELISA Kit
MBS3801897-02 96 Well

Human Carp Antibody ELISA Kit

Sign In for Pricing
View Details
Human Carp Antibody ELISA Kit
MBS3801897-03 5x 96 Well

Human Carp Antibody ELISA Kit

Sign In for Pricing
View Details
Human Carp Antibody ELISA Kit
MBS3801897-04 10x 96 Well

Human Carp Antibody ELISA Kit

Sign In for Pricing
View Details
Anti-CD7 Monoclonal Antibody (Clone:MEM-186) -PE Conjugated
30-2157-100 100 Tests

Anti-CD7 Monoclonal Antibody (Clone:MEM-186) -PE Conjugated

Sign In for Pricing
View Details