Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SsbF Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Single-strand DNA binding protein

Gene Aliases

D616_p97085; Fpla062; Helix-destabilizing protein.

Gene ID

1263584

Accession Number

NP_061439.1

Reactivity

Escherichia coli

Target

May contribute to the conjugative processing of DNA. It has a functional relationship with Psi (plasmid-mediated sos inhibition) proteins.

Type

Protein

Source

E.coli

Sequence

AVRGINKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDKQTGEMREQTEWHRVVLFGKLAEVAGECLRKGAQVYIEGQLRTRSWEDNGITRYVTEILVKTTGTMQMLVRAAGAQTQPEEGQQFSGQPQPEPQAEAGTKKGGAKTKGRGRKAAQPEPQPQPPEGDDYGFSDDIPF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Ssb

Host or Source

Escherichia coli

Protein Name

Plasmid-derived single-stranded DNA-binding protein

Gene Name URL

Ssb

Nucleotide Accession Number

NC_002483.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYTH1 (Cytohesin-1, PH, SEC7 and Coiled-coil Domain-containing Protein 1, SEC7 Homolog B2-1, D17S811E, PSCD1) (APC)
125612-APC 100 µL

CYTH1 (Cytohesin-1, PH, SEC7 and Coiled-coil Domain-containing Protein 1, SEC7 Homolog B2-1, D17S811E, PSCD1) (APC)

Sign In for Pricing
View Details
CXCL10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
17166111 3x 1.0 µg

CXCL10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ZNF581 ORF Vector (Human) (pORF)
ORF012014 1.0 µg DNA

ZNF581 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
MIR4803 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV770612 1.0 µg DNA

MIR4803 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Human LYL1 qPCR Primer Pair
QH17689S 200 Tests

Human LYL1 qPCR Primer Pair

Sign In for Pricing
View Details
SLC40A1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-4906R-BF647-01 20 µL

SLC40A1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details