Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fim3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Serotype 3 fimbrial subunit

Gene Aliases

BP_RS07840; BP1568; serotype 3 fimbrial subunit.

Gene ID

2665596

Accession Number

NP_880302.1

Reactivity

Bordetella pertussis

Target

Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process.

Type

Protein

Source

E.coli

Sequence

NDGTIVITGSISDQTCVIEEPSTLNHIKVVQLPKISKNALRNDGDTAGATPFDIKLKECPQALGALKLYFEPGITTNYDTGDLIAYKQTYNASGNGNLSTVSSATKAKGVEFRLANLNGQHIRMGTDKTTQAAQTFTGKVTNGSKSYTLRYLASYVKKPKEDVDAAQITSYVGFSVVYP

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

35.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BP_RS07840

Host or Source

Bordetella pertussis

Protein Name

Serotype 3 fimbrial subunit

Gene Name URL

BP_RS07840

Nucleotide Accession Number

NC_002929.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZFHX2 activation kit by CRISPRa
GA113888 1 Kit

Human ZFHX2 activation kit by CRISPRa

Sign In for Pricing
View Details
ADAMTS4 (NM_005099) Human Recombinant Protein
TP309226L 1 mg

ADAMTS4 (NM_005099) Human Recombinant Protein

Sign In for Pricing
View Details
CD1a (O10), CF640R conjugate, 0.1mg/mL
BNC400667-100 1x 100 µL

CD1a (O10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GOT1 Recombinant Mouse monoclonal Antibody
HA610154 100 µg

GOT1 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Urine Cell-Free Circulating and Viral Nucleic Acid Purification Mini Kit
59900 50 Preparations

Urine Cell-Free Circulating and Viral Nucleic Acid Purification Mini Kit

Sign In for Pricing
View Details
Cell Division Cycle 34 homolog (CPTC-CDC34-2), CF594 conjugate, 0.1mg/mL
BNC942267-500 1x 500 µL

Cell Division Cycle 34 homolog (CPTC-CDC34-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details