Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fim3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Serotype 3 fimbrial subunit

Gene Aliases

BP_RS07840; BP1568; serotype 3 fimbrial subunit.

Gene ID

2665596

Accession Number

NP_880302.1

Reactivity

Bordetella pertussis

Target

Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process.

Type

Protein

Source

E.coli

Sequence

NDGTIVITGSISDQTCVIEEPSTLNHIKVVQLPKISKNALRNDGDTAGATPFDIKLKECPQALGALKLYFEPGITTNYDTGDLIAYKQTYNASGNGNLSTVSSATKAKGVEFRLANLNGQHIRMGTDKTTQAAQTFTGKVTNGSKSYTLRYLASYVKKPKEDVDAAQITSYVGFSVVYP

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

35.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BP_RS07840

Host or Source

Bordetella pertussis

Protein Name

Serotype 3 fimbrial subunit

Gene Name URL

BP_RS07840

Nucleotide Accession Number

NC_002929.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tmem184a (BC019731) AAV Particle
MR202706A1V 250 µL

Mouse Tmem184a (BC019731) AAV Particle

Sign In for Pricing
View Details
Cux2 Rabbit pAb, PE-Cy5 conjugated
orb3002006 100 µL

Cux2 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
UQCRC2 shRNA (m) Lentiviral Particles
sc-72022-V 200 µL

UQCRC2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Human FGF Basic/FGF2 Protein, No Tag
E40KMH1085 20 µg

Recombinant Human FGF Basic/FGF2 Protein, No Tag

Sign In for Pricing
View Details
Recombinant Human Actin nucleation-promoting factor WASL (C-His)
32-10703-500 500 µg

Recombinant Human Actin nucleation-promoting factor WASL (C-His)

Sign In for Pricing
View Details
NCBP2L Rabbit Polyclonal Antibody (PE)
orb492245 100 µL

NCBP2L Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details