Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNT1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Interferon tau

Gene Aliases

Antiluteolysin; IFNT; IFNT1; IFN-tau1; IFN-tau-1; IFN-tau2; IFN-tau-2; IFN-tau-c2; interferon alpha II; interferon tau-1; interferon tau-2; interferon, trophoblast; interferon-tau1e; interferon-tau3e; TP-1; trophoblast antiluteolytic protein; Trophoblast protein 1; trophoblast protein-1; trophoblast type I interferon; trophoblastin.

Gene ID

317698

Accession Number

NP_001015511.3

Reactivity

Bos taurus|Bovine

Target

Paracrine hormone primarily responsible for maternal recognition of pregnancy. Interacts with endometrial receptors, probably type I interferon receptors, and blocks estrogen receptor expression, preventing the estrogen-induced increase in oxytocin receptor expression in the endometrium. This results in the suppression of the pulsatile endometrial release of the luteolytic hormone prostaglandin F2-alpha, hindering the regression of the corpus luteum (luteolysis) and therefore a return to ovarian cyclicity. This, and a possible direct effect of IFN-tau on prostaglandin synthesis, leads in turn to continued ovarian progesterone secretion, which stimulates the secretion by the endometrium of the nutrients required for the growth of the conceptus. In summary, displays particularly high antiviral and antiproliferative potency concurrently with particular weak cytotoxicity, high antiluteolytic activity and immunomodulatory properties. In contrast with other IFNs, IFN-tau is not virally inducible.

Type

Protein

Source

E.coli

Sequence

CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

23.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IFNT2

Host or Source

Bovine

Protein Name

Interferon tau-1

Gene Name URL

IFNT2

Nucleotide Accession Number

NM_001015511.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Phenylalanyl-tRNA Synthetase 2
7-02748 1 mg

Recombinant Human Phenylalanyl-tRNA Synthetase 2

Sign In for Pricing
View Details
Sodium xylenesulfonate
RM10621-500G 1 unit

Sodium xylenesulfonate

Sign In for Pricing
View Details
SNORD115-37 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2244807 1.0 µg DNA

SNORD115-37 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Pald1 Rat shRNA Plasmid (Locus ID 294508)
TL703300 1 Kit

Pald1 Rat shRNA Plasmid (Locus ID 294508)

Sign In for Pricing
View Details
Rabbit Monoclonal CD38 Antibody (AT13/5) [DyLight 594]
NBP2-81055DL594 0.1 mL

Rabbit Monoclonal CD38 Antibody (AT13/5) [DyLight 594]

Sign In for Pricing
View Details
LentimiRa-Off-mmu-miR-344c-5p Vector
mm30625 500 ng

LentimiRa-Off-mmu-miR-344c-5p Vector

Sign In for Pricing
View Details