Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sialic acid-binding lectin Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Sialic acid-binding lectin, EC 3.1.27.-

Reactivity

Rana japonica

Target

The S-lectins in frog eggs may be involved in the fertilization and development of the frog embryo. This lectin preferentially agglutinate a large variety of tumor cells, but it does not agglutinate non-transformed cells and erythrocytes.

Type

Protein

Source

E.coli

Sequence

QNWAKFQEKHIPNTSNINCNTIMDKSIYIVGGQCKERNTFIISSATTVKAICSGASTNRNVLSTTRFQLNTCIRSATAPRPCPYNSRTETNVICVKCENRLPVHFAGIGRC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.3 kDa

Protein Length

Recombinant

Host or Source

Rana japonica

Protein Name

Sialic acid-binding lectin

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal UBIAD1 Antibody [HRP]
NBP2-82046H 0.1 mL

Rabbit Polyclonal UBIAD1 Antibody [HRP]

Sign In for Pricing
View Details
Rabbit Polyclonal USP22 Antibody
NBP1-49644SS 0.025 mL

Rabbit Polyclonal USP22 Antibody

Sign In for Pricing
View Details
Cavy Proteinase 3 ELISA Kit
MBS080047 Inquire

Cavy Proteinase 3 ELISA Kit

Sign In for Pricing
View Details
TMEM9B CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
47121154 3x 1.0 µg DNA

TMEM9B CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal GAPDH Antibody (6C5cc)
NB600-502-0.2mg 0.2 mg

Mouse Monoclonal GAPDH Antibody (6C5cc)

Sign In for Pricing
View Details
ZNF273 Recombinant Protein (Human)
RP035695 100 µg

ZNF273 Recombinant Protein (Human)

Sign In for Pricing
View Details