Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sialic acid-binding lectin Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Sialic acid-binding lectin, EC 3.1.27.-

Reactivity

Rana japonica

Target

The S-lectins in frog eggs may be involved in the fertilization and development of the frog embryo. This lectin preferentially agglutinate a large variety of tumor cells, but it does not agglutinate non-transformed cells and erythrocytes.

Type

Protein

Source

E.coli

Sequence

QNWAKFQEKHIPNTSNINCNTIMDKSIYIVGGQCKERNTFIISSATTVKAICSGASTNRNVLSTTRFQLNTCIRSATAPRPCPYNSRTETNVICVKCENRLPVHFAGIGRC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.3 kDa

Protein Length

Recombinant

Host or Source

Rana japonica

Protein Name

Sialic acid-binding lectin

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal AntibodyCC2 Rabbit Monoclonal Antibody
E49Y6858 100 µL

Rabbit Monoclonal AntibodyCC2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
UFC1 Recombinant Protein (Mouse)
RP182957 100 µg

UFC1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Inhibitor hsa-miR-4462 AAV miRNA Vector
Amh3145600 500 ng

Inhibitor hsa-miR-4462 AAV miRNA Vector

Sign In for Pricing
View Details
NOC4L Rabbit Polyclonal Antibody (FITC)
orb2124534 100 µL

NOC4L Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
GRB7 Antibody
MBS8517350-01 0.05 mg

GRB7 Antibody

Sign In for Pricing
View Details
GRB7 Antibody
MBS8517350-02 0.1 mg

GRB7 Antibody

Sign In for Pricing
View Details