Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VP4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Hemagglutinin.

Reactivity

Human Rotavirus A|Rotavirus A

Target

Outer capsid protein VP4: Spike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virulence. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. It is subsequently lost, together with VP7, following virus entry into the host cell. Following entry into the host cell, low intracellular or intravesicular Ca (2+) concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7. During the virus exit from the host cell, VP4 seems to be required to target the newly formed virions to the host cell lipid rafts.

Type

Protein

Source

E.coli

Sequence

AQVSEDIIISKTSLWKEMQYNRDIIIRFKFNNSIIKLGGLGYKWSEISFKAANYQYNYLRDGEQVTAHTTCSVNGVNNFSYNGGLLPTHFSISRYEVIKENSYVYVDYWDDSQAFRNMVYVRSLAANLNSVKCSGGNYNFQMPVGAWPVMSGGAVSLHFAGVTLSTQFTDFVSLNSLRFRFSLTVEEPPFSILRTRVSGLYGLPASNPNSGHEYYEIAGRFSLISLVPSNDDY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.3 kDa

Protein Length

Recombinant

Host or Source

Rotavirus A

Protein Name

Outer capsid protein VP4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genorise® Biotinylated Mouse MMP-9 Polyclonal antibody
GR138016 50 mg

Genorise® Biotinylated Mouse MMP-9 Polyclonal antibody

Sign In for Pricing
View Details
Mouse Cytochrome b reductase 1 (CYBRD1) ELISA Kit
MBS7212241-01 48 Well

Mouse Cytochrome b reductase 1 (CYBRD1) ELISA Kit

Sign In for Pricing
View Details
Mouse Cytochrome b reductase 1 (CYBRD1) ELISA Kit
MBS7212241-02 96 Well

Mouse Cytochrome b reductase 1 (CYBRD1) ELISA Kit

Sign In for Pricing
View Details
Mouse Cytochrome b reductase 1 (CYBRD1) ELISA Kit
MBS7212241-03 5x 96 Well

Mouse Cytochrome b reductase 1 (CYBRD1) ELISA Kit

Sign In for Pricing
View Details
Mouse Cytochrome b reductase 1 (CYBRD1) ELISA Kit
MBS7212241-04 10x 96 Well

Mouse Cytochrome b reductase 1 (CYBRD1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse KRR1 small subunit processome component homolog (Krr1)
MBS1330848-01 0.02 mg (E-Coli)

Recombinant Mouse KRR1 small subunit processome component homolog (Krr1)

Sign In for Pricing
View Details