Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Con-ikot-ikot Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Con-ikot-ikot

Reactivity

Conus striatus

Target

Potently and selectively blocks the desensitization of ionotropic glutamate AMPA receptor (GRIA1, GRIA2, GRIA3 and GRIA4) . Can also open already desensitized GRIA1 receptors. Binds to a different site than does the drug cyclothiazide (PubMed:19481459) . The toxin acts like a straightjacket on the ligand-binding domain (LBD) "gating ring" of the receptor, restraining the domains via both intra- and interdimer cross-links such that agonist-induced closure of the LBD "clamshells" is transduced into an irislike expansion of the gating ring (PubMed:25103405) . Application of the toxin to hippocampal slices causes a large and rapid increase in resting AMPAR-mediated current leading to neuronal death (PubMed:19481459) .

Type

Protein

Source

E.coli

Sequence

SGPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

13.4 kDa

Protein Length

Recombinant

Host or Source

Conus striatus

Protein Name

Con-ikot-ikot

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC6A14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2161705 3x 1.0 µg

SLC6A14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Uridine Monophosphate Kinase 2, CT (Cytidine monophosphokinase 2, Testis-specific protein, UCK 2, UK, UMPK, Uridine-cytidine kinase 2, Uridine monophosphokinase 2)
MBS630380-01 0.2 mL

Uridine Monophosphate Kinase 2, CT (Cytidine monophosphokinase 2, Testis-specific protein, UCK 2, UK, UMPK, Uridine-cytidine kinase 2, Uridine monophosphokinase 2)

Sign In for Pricing
View Details
Uridine Monophosphate Kinase 2, CT (Cytidine monophosphokinase 2, Testis-specific protein, UCK 2, UK, UMPK, Uridine-cytidine kinase 2, Uridine monophosphokinase 2)
MBS630380-02 5x 0.2 mL

Uridine Monophosphate Kinase 2, CT (Cytidine monophosphokinase 2, Testis-specific protein, UCK 2, UK, UMPK, Uridine-cytidine kinase 2, Uridine monophosphokinase 2)

Sign In for Pricing
View Details
GAPDHP14 CRISPR All-in-one AAV vector set (with saCas9)(Human)
21248151 3x 1.0 µg DNA

GAPDHP14 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Apoptosis/Necroptosis Antibody Sampler Kit, BioAssayTM discontinued
473929 5x 20 µL

Apoptosis/Necroptosis Antibody Sampler Kit, BioAssayTM discontinued

Sign In for Pricing
View Details
CSTF1 (Cleavage Stimulation Factor Subunit 1, CF-1 50kD Subunit, Cleavage Stimulation Factor 50kD Subunit, CSTF 50kD Subunit, CstF-50) (MaxLight 650)
125423-ML650 100 µL

CSTF1 (Cleavage Stimulation Factor Subunit 1, CF-1 50kD Subunit, Cleavage Stimulation Factor 50kD Subunit, CSTF 50kD Subunit, CstF-50) (MaxLight 650)

Sign In for Pricing
View Details