Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DegP Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Periplasmic serine endoprotease DegP

Gene Aliases

B0161; ECK0160; Heat shock protein DegP; htrA; periplasmic serine endoprotease DegP; Protease Do; ptd.

Gene ID

947139

Accession Number

NP_414703.1

Reactivity

Escherichia coli

Target

DegP acts as a chaperone at low temperatures but switches to a peptidase (heat shock protein) at higher temperatures (PubMed:10319814) . Degrades transiently denatured and unfolded or misfolded proteins which accumulate in the periplasm following heat shock or other stress conditions (PubMed:16303867) . DegP is efficient with Val-Xaa and Ile-Xaa peptide bonds, suggesting a preference for beta-branched side chain amino acids (PubMed:8830688) . Only unfolded proteins devoid of disulfide bonds appear capable of being cleaved, thereby preventing non-specific proteolysis of folded proteins (PubMed:8830688) . Its proteolytic activity is essential for the survival of cells at elevated temperatures (PubMed:7557477) . It can degrade IciA, Ada, casein, globin and PapA. DegP shares specificity with DegQ (PubMed:8830688) . DegP is also involved in the biogenesis of partially folded outer-membrane proteins (OMP) .

Type

Protein

Source

E.coli

Sequence

AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

62.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DegP

Host or Source

Escherichia coli

Protein Name

Periplasmic serine endoprotease DegP

Gene Name URL

DegP

Nucleotide Accession Number

NC_000913.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRNPA1P15 AAV Vector (Human) (CMV)
23708101 1 µg

HNRNPA1P15 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Recombinant Human CD94/KLRD1 Protein, His Tag
KMH267 50 µg

Recombinant Human CD94/KLRD1 Protein, His Tag

Sign In for Pricing
View Details
GABRA1/GABA A Receptor alpha 1 Rabbit Polyclonal Antibody (PE)
orb495178 100 µL

GABRA1/GABA A Receptor alpha 1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
PUS7 Protein Vector (Human) (pPM-C-HA)
PV033711 500 ng

PUS7 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
USP37 Antibody
E306091 100 µg - 200 µL

USP37 Antibody

Sign In for Pricing
View Details
Mouse Pseudorabiesvirus GE (PRV-GE Ab) ELISA Kit
YP-W24199-01 48 Tests

Mouse Pseudorabiesvirus GE (PRV-GE Ab) ELISA Kit

Sign In for Pricing
View Details