Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FbpB Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

30 kDa extracellular protein; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex B; Extracellular alpha-antigen; Fibronectin-binding protein B.

Accession Number

WP_003409456.1

Reactivity

Mycobacterium tuberculosis

Target

The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs) . They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha, alpha-trehalose dimycolate (TDM, cord factor) . They catalyze the transfer of a mycoloyl residue from one molecule of alpha, alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM (By similarity) .

Type

Protein

Source

E.coli

Sequence

FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

46.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FBPB

Protein Name

Diacylglycerol acyltransferase/mycolyltransferase Ag85B

Gene Name URL

FBPB

Nucleotide Accession Number

NZ_KK341227.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Hes1 shRNA (UAS) - Lentiviral mouse Hes1 shRNA (UAS, GFP) (100)
GTR15177357 1 Vial

Lentiviral mouse Hes1 shRNA (UAS) - Lentiviral mouse Hes1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Polyclonal DKK3 Antibody
APR03166G 0.05ml

Polyclonal DKK3 Antibody

Sign In for Pricing
View Details
ATAD3C sgRNA CRISPR Lentivector (Human) (Target 3)
K0139504 1.0 µg DNA

ATAD3C sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human Adenylate cyclase type 3, ADCY3 ELISA KIT
ELI-34973h 96 Tests

Human Adenylate cyclase type 3, ADCY3 ELISA KIT

Sign In for Pricing
View Details
KLHL13 (BKLHD2, KIAA1309) discontinued
510966 100 µg

KLHL13 (BKLHD2, KIAA1309) discontinued

Sign In for Pricing
View Details
ADRA1A Polyclonal Antibody
E-AB-62002-01 60 µL

ADRA1A Polyclonal Antibody

Sign In for Pricing
View Details