Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dac g 3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Dac g III.

Reactivity

Dactylis glomerata

Type

Protein

Source

E.coli

Sequence

VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

26.9 kDa

Protein Length

Recombinant

Host or Source

Dactylis glomerata

Protein Name

Pollen allergen Dac g 3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS28P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV784895 1.0 µg DNA

RPS28P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Human IMPA2 Protein, N-His
orb2962952-01 50 µg

Recombinant Human IMPA2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IMPA2 Protein, N-His
orb2962952-02 100 µg

Recombinant Human IMPA2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IMPA2 Protein, N-His
orb2962952-03 1 mg

Recombinant Human IMPA2 Protein, N-His

Sign In for Pricing
View Details
P-Octylphenyl salicylate
O02180 100 g

P-Octylphenyl salicylate

Sign In for Pricing
View Details
PRSS7 (TMPRSS15, ENTK, PRSS7, Enteropeptidase, Enterokinase, Serine Protease 7, Transmembrane Protease Serine 15, Enteropeptidase Non-catalytic Heavy Chain, Enteropeptidase Catalytic Light Chain, MGC133046) (MaxLight 405)
MBS6192035-01 0.1 mL

PRSS7 (TMPRSS15, ENTK, PRSS7, Enteropeptidase, Enterokinase, Serine Protease 7, Transmembrane Protease Serine 15, Enteropeptidase Non-catalytic Heavy Chain, Enteropeptidase Catalytic Light Chain, MGC133046) (MaxLight 405)

Sign In for Pricing
View Details