Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GltX1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Glutamate--tRNA ligase

Gene Aliases

Glutamate--tRNA ligase; Glutamyl-tRNA synthetase 1; HP_0476; HP_RS02355; HP0476.

Gene ID

898901

Accession Number

NP_207274.1

Reactivity

Helicobacter pylori

Target

Catalyzes the attachment of glutamate to tRNA (Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA (Glu) .

Type

Protein

Source

E.coli

Sequence

MSLIVTRFAPSPTGYLHIGGLRTAIFNYLFARANQGKFFLRIEDTDLSRNSIEAANAIIEAFKWVGLEYDGEILYQSKRFEIYKEYIQKLLDEDKAYYCYMSKEELDALREEQKARKETPRYDNRYRDFKGTPPKGIEPVVRIKVPQNEVIGFNDGVKGEVKVNTNELDDFIIARSDGTPTYNFVVTIDDALMGITDVIRGDDHLSNTPKQIVLYKALNFKIPNFFHVPMILNEEGQKLSKRHGATNVMDYQEMGYLKEALVNFLARLGWSYQDKEVFSMQELLELFDPKDLNSSPSCFSWHKLNWLNAHYLKNQSVQELLKLLKPFSFSDLSHLNPTQLDRLLDALKERSQTLKELALKIDEVLIAPVEYEEKVFKKLNQALVMPLLEKFKLELNKANFNDESALENAMRQIIEEEKIKAGSFMQPLRLALLGKGGGIGLKEALFILGKTESVKRIEDFLKN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

69.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HP_RS02355

Host or Source

Helicobacter pylori

Protein Name

Glutamate--tRNA ligase 1

Gene Name URL

HP_RS02355

Nucleotide Accession Number

NC_000915.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Snrp116 Polyclonal Antibody
orb1412135 100 µL

Snrp116 Polyclonal Antibody

Sign In for Pricing
View Details
FIG4, CT (FIG4, KIAA0274, SAC3, Polyphosphoinositide phosphatase, Phosphatidylinositol 3,5-bisphosphate 5-phosphatase, SAC domain-containing protein 3) (Azide free) (HRP)
MBS6299268-01 0.2 mL

FIG4, CT (FIG4, KIAA0274, SAC3, Polyphosphoinositide phosphatase, Phosphatidylinositol 3,5-bisphosphate 5-phosphatase, SAC domain-containing protein 3) (Azide free) (HRP)

Sign In for Pricing
View Details
FIG4, CT (FIG4, KIAA0274, SAC3, Polyphosphoinositide phosphatase, Phosphatidylinositol 3,5-bisphosphate 5-phosphatase, SAC domain-containing protein 3) (Azide free) (HRP)
MBS6299268-02 5x 0.2 mL

FIG4, CT (FIG4, KIAA0274, SAC3, Polyphosphoinositide phosphatase, Phosphatidylinositol 3,5-bisphosphate 5-phosphatase, SAC domain-containing protein 3) (Azide free) (HRP)

Sign In for Pricing
View Details
Mouse Tctn2 activation kit by CRISPRa
GA207621 1 Kit

Mouse Tctn2 activation kit by CRISPRa

Sign In for Pricing
View Details
CCPG1 HDR Plasmid (m)
sc-428295-HDR 20 µg

CCPG1 HDR Plasmid (m)

Sign In for Pricing
View Details
Rps7-set siRNA/shRNA/RNAi Lentivector (Mouse)
42629094 4x 500 ng

Rps7-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details