Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lychnin Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Ribosome-inactivating protein lychnin, EC 3.2.2.22

Reactivity

Silene chalcedonica

Target

Ribosome-inactivating protein of type 1, inhibits protein synthesis in animal cells. Inhibits cell-free translation in rabbit reticulocyte lysate system with an IC (50) of 0.17 nM.

Type

Protein

Source

E.coli

Sequence

RPSWTVDSDSAKYSSFLDSLREEFGRGTPKVCNIPVTKKANNDKFVLVNLVLPFNRNTITLAFRASDAYLVGFQDRDSKTNKLRANFFSDEYRALSGKYKSIFTDAEVLAPALPCASTYTDLQNKAGVSREKLSLGVSSLQTAFTAVYGKVFTGKNVAKFALISIQMVAEAARFKYIEDQVINRGMYSSFEAGARITLLENNWSKISEQYHKSCKLGGGQFTEEEMKLGLLLYN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.1 kDa

Protein Length

Recombinant

Host or Source

Silene chalcedonica

Protein Name

Ribosome-inactivating protein lychnin

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gtpbp2 (NM_019581) Mouse Tagged ORF Clone Lentiviral Particle
MR216540L3V 200 µL

Gtpbp2 (NM_019581) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SMUG1 (1-270, His-tag) Human Protein
AR50672PU-S 100 µg

SMUG1 (1-270, His-tag) Human Protein

Sign In for Pricing
View Details
FCER1G (NM_004106) Human Recombinant Protein
TP307585L 1 mg

FCER1G (NM_004106) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal SARS-CoV-2 Spike Antibody [Alexa Fluor 750]
NBP3-11940AF750 0.1 mL

Rabbit Polyclonal SARS-CoV-2 Spike Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Rabbit Polyclonal FAM107A Antibody [Alexa Fluor 647]
NBP2-97556AF647 0.1 mL

Rabbit Polyclonal FAM107A Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Ticagrelor EP Impurity E (hydrochloride)
HY-I0180A-01 1 g

Ticagrelor EP Impurity E (hydrochloride)

Sign In for Pricing
View Details