Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Disintegrin EC3B Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Disintegrin EC3B

Reactivity

Echis carinatus

Target

Inhibits adhesion of cells expressing alpha-4/beta-1 (ITGA4/ITGB1) and alpha-4/beta-7 (ITGA4/ITGB7) integrins to the natural ligands vascular cell adhesion molecule 1 (VCAM-1) and mucosal addressin cell adhesion molecule 1 (MADCAM-1) . It is also a weaker inhibitor of alpha-5/beta-1 (ITGA5/ITGB1) and alpha-2b/beta-3 (ITGA2B/ITGB3) integrins. The inhibitory activity of EC3 towards alpha-4 integrins is associated with the MLD sequence of EC3B subunit. The ability of EC3 to inhibit ITGA5/ITGB1 resides in both subunits A and B.

Type

Protein

Source

E.coli

Sequence

NSVHPCCDPVKCEPREGEHCISGPCCRNCKFLNAGTICKRAMLDGLNDYCTGISTDCPRNRYKGKED

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

23.4 kDa

Protein Length

Recombinant

Host or Source

Echis carinatus

Protein Name

Disintegrin EC3B

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-SRC-1 (676–700) TFA
T83752-01 100 mg

Biotin-SRC-1 (676–700) TFA

Sign In for Pricing
View Details
Biotin-SRC-1 (676–700) TFA
T83752-02 25 mg

Biotin-SRC-1 (676–700) TFA

Sign In for Pricing
View Details
Biotin-SRC-1 (676–700) TFA
T83752-03 50 mg

Biotin-SRC-1 (676–700) TFA

Sign In for Pricing
View Details
Ehd4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3787907 1.0 µg DNA

Ehd4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
CDC42EP5 Human shRNA Plasmid Kit (Locus ID 148170)
TL319883 1 Kit

CDC42EP5 Human shRNA Plasmid Kit (Locus ID 148170)

Sign In for Pricing
View Details
Rat Prostaglandin Endoperoxide Synthase 1 ELISA Kit
MBS724816-01 48 Well

Rat Prostaglandin Endoperoxide Synthase 1 ELISA Kit

Sign In for Pricing
View Details