Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Disintegrin EC3B Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Disintegrin EC3B

Reactivity

Echis carinatus

Target

Inhibits adhesion of cells expressing alpha-4/beta-1 (ITGA4/ITGB1) and alpha-4/beta-7 (ITGA4/ITGB7) integrins to the natural ligands vascular cell adhesion molecule 1 (VCAM-1) and mucosal addressin cell adhesion molecule 1 (MADCAM-1) . It is also a weaker inhibitor of alpha-5/beta-1 (ITGA5/ITGB1) and alpha-2b/beta-3 (ITGA2B/ITGB3) integrins. The inhibitory activity of EC3 towards alpha-4 integrins is associated with the MLD sequence of EC3B subunit. The ability of EC3 to inhibit ITGA5/ITGB1 resides in both subunits A and B.

Type

Protein

Source

E.coli

Sequence

NSVHPCCDPVKCEPREGEHCISGPCCRNCKFLNAGTICKRAMLDGLNDYCTGISTDCPRNRYKGKED

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

23.4 kDa

Protein Length

Recombinant

Host or Source

Echis carinatus

Protein Name

Disintegrin EC3B

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human SESN2 pAb
PA7831-01 50 μL

Rabbit Anti-Human SESN2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human SESN2 pAb
PA7831-02 100 μL

Rabbit Anti-Human SESN2 pAb

Sign In for Pricing
View Details
Tide Fluor™ 3 amine [TF3 amine] *Superior replacement for Cy3*
2269-AAT 1 mg

Tide Fluor™ 3 amine [TF3 amine] *Superior replacement for Cy3*

Sign In for Pricing
View Details
ARHGEF5 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
12343154 3x 1.0 µg DNA

ARHGEF5 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Taar4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
46024114 3x 1.0 µg

Taar4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
IDE (42-1019, His-Tag) Human Recombinant Protein
TP724587L 100 µg

IDE (42-1019, His-Tag) Human Recombinant Protein

Sign In for Pricing
View Details