Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZipA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Cell division protein ZipA

Gene Aliases

B2412; cell division protein ZipA; ECK2407; FtsZ interacting protein A.

Gene ID

946869

Accession Number

NP_416907.1

Reactivity

Escherichia coli

Target

Essential cell division protein that stabilizes the FtsZ protofilaments by cross-linking them and that serves as a cytoplasmic membrane anchor for the Z ring (PubMed:9008158, PubMed:11847116, PubMed:22164258, PubMed:22304478, PubMed:23233671) . Also required for the recruitment to the septal ring of the downstream cell division proteins FtsK, FtsQ, FtsL and FtsN (PubMed:11847116, PubMed:11948172) . ZipA overproduction protects FtsZ from degradation by ClpP by preventing recognition by ClpX (PubMed:23233671) . Does not affect the GTPase activity of FtsZ (PubMed:10209756) .

Type

Protein

Source

E.coli

Sequence

MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMKSKRDDDSYDEDVEDDEGVGEVRVHRVNHAPANAQEHEAARPSPQHQYQPPYASAQPRQPVQQPPEAQVPPQHAPHPAQPVQQPAYQPQPEQPLQQPVSPQVAPAPQPVHSAPQPAQQAFQPAEPVAAPQPEPVAEPAPVMDKPKRKEAVIIMNVAAHHGSELNGELLLNSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQNFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDANA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

52.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ZipA

Host or Source

Escherichia coli

Protein Name

Cell division protein ZipA

Gene Name URL

ZipA

Nucleotide Accession Number

NC_000913.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Active Interleukin 10 (IL10)
TRV-0001265-01 10 µg

Active Interleukin 10 (IL10)

Sign In for Pricing
View Details
Active Interleukin 10 (IL10)
TRV-0001265-02 50 µg

Active Interleukin 10 (IL10)

Sign In for Pricing
View Details
Active Interleukin 10 (IL10)
TRV-0001265-03 100 µg

Active Interleukin 10 (IL10)

Sign In for Pricing
View Details
Active Interleukin 10 (IL10)
TRV-0001265-04 200 µg

Active Interleukin 10 (IL10)

Sign In for Pricing
View Details
Active Interleukin 10 (IL10)
TRV-0001265-05 500 µg

Active Interleukin 10 (IL10)

Sign In for Pricing
View Details
Active Interleukin 10 (IL10)
TRV-0001265-06 1 mg

Active Interleukin 10 (IL10)

Sign In for Pricing
View Details