Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XPC Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

XPC complex subunit, DNA damage recognition and repair factor

Gene Aliases

DNA repair protein complementing XP-C cells; mutant xeroderma pigmentosum group C; p125; RAD4; Xeroderma pigmentosum group C-complementing protein; xeroderma pigmentosum, complementation group C; XP3; XPCC.

Gene ID

7508

Accession Number

NP_004619.3

Reactivity

Homo sapiens|Human

Target

Involved in global genome nucleotide excision repair (GG-NER) by acting as damage sensing and DNA-binding factor component of the XPC complex. Has only a low DNA repair activity by itself which is stimulated by RAD23B and RAD23A. Has a preference to bind DNA containing a short single-stranded segment but not to damaged oligonucleotides. This feature is proposed to be related to a dynamic sensor function: XPC can rapidly screen duplex DNA for non-hydrogen-bonded bases by forming a transient nucleoprotein intermediate complex which matures into a stable recognition complex through an intrinsic single-stranded DNA-binding activity.

Type

Protein

Source

E.coli

Sequence

SLPAASSSSSSSKRGKKMCSDGEKAEKRSIAGIDQWLEVFCEQEEKWVCVDCVHGVVGQPLTCYKYATKPMTYVVGIDSDGWVRDVTQRYDPVWMTVTRKCRVDAEWWAETLRPYQSPFMDREKKEDLEFQAKHMDQPLPTAIGLYKNHPLYALKRHLLKYEAIYPETAAILGYCRGEAVYSRDCVHTLHSRDTWLKKARVVRLGEVPYKMVKGFSNRARKARLAEPQLREENDLGLFG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

XPC

Host or Source

Human

Protein Name

DNA repair protein complementing XP-C cells

Gene Name URL

XPC

Nucleotide Accession Number

NM_004628.4

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glomulin (GLMN) Antibody
abx125881-01 60 µL

Glomulin (GLMN) Antibody

Sign In for Pricing
View Details
Glomulin (GLMN) Antibody
abx125881-02 120 µL

Glomulin (GLMN) Antibody

Sign In for Pricing
View Details
Glomulin (GLMN) Antibody
abx125881-03 200 µL

Glomulin (GLMN) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Csta2 shRNA (UAS) - Lentiviral mouse Csta2 shRNA (UAS, RFP) (25)
GTR15111203 1 Vial

Lentiviral mouse Csta2 shRNA (UAS) - Lentiviral mouse Csta2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
2- (Methoxycarbonyl) -4H-thieno[3,2-b]pyrrole-5-carboxylic acid
RPD14001-01 50 mg

2- (Methoxycarbonyl) -4H-thieno[3,2-b]pyrrole-5-carboxylic acid

Sign In for Pricing
View Details
2- (Methoxycarbonyl) -4H-thieno[3,2-b]pyrrole-5-carboxylic acid
RPD14001-02 0.5 g

2- (Methoxycarbonyl) -4H-thieno[3,2-b]pyrrole-5-carboxylic acid

Sign In for Pricing
View Details