Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF7 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

DDB1 and CUL4 associated factor 7

Gene Aliases

AN11; DDB1- and CUL4-associated factor 7; HAN11; human anthocyanin; seven-WD-repeat protein of the AN11 family-1; SWAN-1; WD repeat-containing protein 68; WD repeat-containing protein An11 homolog; WDR68.

Gene ID

10238

Accession Number

NP_005819.3

Reactivity

Homo sapiens|Human

Target

Involved in craniofacial development. Acts upstream of the EDN1 pathway and is required for formation of the upper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the first and second arches (By similarity) . Associates with DIAPH1 and controls GLI1 transcriptional activity. Could be involved in normal and disease skin development. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.

Type

Protein

Source

E.coli

Sequence

MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

54.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DCAF7

Host or Source

Human

Protein Name

DDB1- and CUL4-associated factor 7

Gene Name URL

DCAF7

Nucleotide Accession Number

NM_005828.4

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-(Ketocaproyl)-L-homoserine Lactone
TRC-K180750-500MG 500 mg

N-(Ketocaproyl)-L-homoserine Lactone

Sign In for Pricing
View Details
Human p8 (NUPR1) (NM_012385) AAV Particle
RC200585A1V 250 µL

Human p8 (NUPR1) (NM_012385) AAV Particle

Sign In for Pricing
View Details
ADAT1 (HADAT1, tRNA-specific Adenosine Deaminase 1) (HRP)
MBS6405523-01 0.1 mL

ADAT1 (HADAT1, tRNA-specific Adenosine Deaminase 1) (HRP)

Sign In for Pricing
View Details
ADAT1 (HADAT1, tRNA-specific Adenosine Deaminase 1) (HRP)
MBS6405523-02 5x 0.1 mL

ADAT1 (HADAT1, tRNA-specific Adenosine Deaminase 1) (HRP)

Sign In for Pricing
View Details
GAPDHS (Glyceraldehyde-3-Phosphate Dehydrogenase, Testis-Specific, Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic)
481594 100 µL

GAPDHS (Glyceraldehyde-3-Phosphate Dehydrogenase, Testis-Specific, Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic)

Sign In for Pricing
View Details
CKM ELISA Kit (Pig) (OKEH03845)
OKEH03845 96 Well

CKM ELISA Kit (Pig) (OKEH03845)

Sign In for Pricing
View Details