What is the catalog number for UCHL5 Recombinant Protein?

The catalog number for UCHL5 Recombinant Protein is OPCA01920-100UG.

What sizes are available for UCHL5 Recombinant Protein?

UCHL5 Recombinant Protein is available in the following size(s): 100 µg.

Is UCHL5 Recombinant Protein in stock?

UCHL5 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

UCHL5 Recombinant Protein

Selected Variant

OPCA01920-100UG

Size: 100 µg

Product Specifications

CAS Number

9000-83-3

Gene Name

Ubiquitin C-terminal hydrolase L5

Gene Aliases

CGI-70; INO80 complex subunit R; INO80R; ubiquitin carboxyl-terminal esterase L5; ubiquitin carboxyl-terminal hydrolase isozyme L5; ubiquitin carboxyl-terminal hydrolase L5; ubiquitin C-terminal hydrolase UCH37; ubiquitin thioesterase L5; UCH37; UCH-L5.

Gene ID

51377

Accession Number

NP_001186190.1

Reactivity

Homo sapiens|Human

Target

Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1.

Type

Protein

Source

E.coli

Sequence

MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKFEKHFEKTLLGK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

53.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

UCHL5

Host or Source

Human

Protein Name

Ubiquitin carboxyl-terminal hydrolase isozyme L5

Gene Name URL

UCHL5

Nucleotide Accession Number

NM_001199261.1

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PPP1R15B Antibody Picoband®, PE Conjugate

A10225-1-PE 100 µg/Vial