Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Tumor necrosis factor

Gene Aliases

Cachectin; TNF-a; TNF-alpha; tumor necrosis factor; tumor necrosis factor (TNF superfamily, member 2) ; tumor necrosis factor alpha; tumor necrosis factor ligand superfamily member 2.

Gene ID

443540

Accession Number

NP_001020031.1

Reactivity

Ovis aries|Sheep

Target

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.

Type

Protein

Source

E.coli

Sequence

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

44.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TNF

Host or Source

Sheep

Protein Name

Tumor necrosis factor

Gene Name URL

TNF

Nucleotide Accession Number

NM_001024860.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIP5K3 (PIKFYVE, 1-phosphatidylinositol 3-phosphate 5-kinase, Phosphatidylinositol 3-phosphate 5-kinase, FYVE Finger-containing Phosphoinositide Kinase, PIKfyve, Phosphatidylinositol 3-phosphate 5-kinase Type III, PIPkin-III, Type III PIP Kinase, KIAA0981, FLJ37746, MGC40423) (MaxLight 405) discontinued
131366-ML405 100 µL

PIP5K3 (PIKFYVE, 1-phosphatidylinositol 3-phosphate 5-kinase, Phosphatidylinositol 3-phosphate 5-kinase, FYVE Finger-containing Phosphoinositide Kinase, PIKfyve, Phosphatidylinositol 3-phosphate 5-kinase Type III, PIPkin-III, Type III PIP Kinase, KIAA0981, FLJ37746, MGC40423) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Human Protein N-terminal asparagine amidohydrolase (NTAN1)
MBS1317795-01 0.02 mg (E-Coli)

Recombinant Human Protein N-terminal asparagine amidohydrolase (NTAN1)

Sign In for Pricing
View Details
Recombinant Human Protein N-terminal asparagine amidohydrolase (NTAN1)
MBS1317795-02 0.02 mg (Yeast)

Recombinant Human Protein N-terminal asparagine amidohydrolase (NTAN1)

Sign In for Pricing
View Details
Recombinant Human Protein N-terminal asparagine amidohydrolase (NTAN1)
MBS1317795-03 0.1 mg (E-Coli)

Recombinant Human Protein N-terminal asparagine amidohydrolase (NTAN1)

Sign In for Pricing
View Details
Recombinant Human Protein N-terminal asparagine amidohydrolase (NTAN1)
MBS1317795-04 0.1 mg (Yeast)

Recombinant Human Protein N-terminal asparagine amidohydrolase (NTAN1)

Sign In for Pricing
View Details
Recombinant Human Protein N-terminal asparagine amidohydrolase (NTAN1)
MBS1317795-05 0.02 mg (Baculovirus)

Recombinant Human Protein N-terminal asparagine amidohydrolase (NTAN1)

Sign In for Pricing
View Details