Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tlr7 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Toll-like receptor 7

Gene Aliases

Toll like receptor 7; toll-like receptor 7.

Gene ID

170743

Accession Number

NP_001277684.1

Reactivity

Mouse|Mus musculus

Target

Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

Type

Protein

Source

E.coli

Sequence

FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

63.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Tlr7

Host or Source

Mouse

Protein Name

Toll-like receptor 7

Gene Name URL

Tlr7

Nucleotide Accession Number

NM_001290755.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-548a-5p miRNA Antagomir
MBS8316570-01 10 nmol

hsa-miR-548a-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-548a-5p miRNA Antagomir
MBS8316570-02 20 nmol

hsa-miR-548a-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-548a-5p miRNA Antagomir
MBS8316570-03 5x 20 nmol

hsa-miR-548a-5p miRNA Antagomir

Sign In for Pricing
View Details
Mapt, Phosphorylated (S416) (Tau Protein, Microtubule-associated Protein Tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND) (MaxLight 550)
MBS6425986-01 0.1 mL

Mapt, Phosphorylated (S416) (Tau Protein, Microtubule-associated Protein Tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND) (MaxLight 550)

Sign In for Pricing
View Details
Mapt, Phosphorylated (S416) (Tau Protein, Microtubule-associated Protein Tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND) (MaxLight 550)
MBS6425986-02 5x 0.1 mL

Mapt, Phosphorylated (S416) (Tau Protein, Microtubule-associated Protein Tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Human CXCL10/IP-10 Protein, N-His
AP90502 50 µg

Recombinant Human CXCL10/IP-10 Protein, N-His

Sign In for Pricing
View Details