Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TJP1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Tight junction protein 1

Gene Aliases

Tight junction protein 1; tight junction protein 1 (zona occludens 1) ; tight junction protein ZO-1; ZO1; ZO-1; Zona occludens protein 1; zonula occludens protein 1.

Gene ID

403752

Accession Number

NP_001003140.1

Reactivity

Canis lupus|Dog

Target

TJP1, TJP2, and TJP3 are closely related scaffolding proteins that link tight junction (TJ) transmembrane proteins such as claudins, junctional adhesion molecules, and occludin to the actin cytoskeleton (PubMed:9792688, PubMed:10575001, PubMed:27802160) . The tight junction acts to limit movement of substances through the paracellular space and as a boundary between the compositionally distinct apical and basolateral plasma membrane domains of epithelial and endothelial cells. Necessary for lumenogenesis, and particularly efficient epithelial polarization and barrier formation (PubMed:27802160) . Plays a role in the regulation of cell migration by targeting CDC42BPBb to the leading edge of migrating cells (By similarity) . With TJP2 and TJP3, participates to the junctional retention and stability of the transcription factor DBPA, but is not involved in its shuttling to the nucleus (PubMed:24986862) .

Type

Protein

Source

E.coli

Sequence

VVATARGVFNNNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGANCVSVLIDHF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TJP1

Host or Source

Dog

Protein Name

Tight junction protein ZO-1

Gene Name URL

TJP1

Nucleotide Accession Number

NM_001003140.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sort1 Mouse Gene Knockout Kit (CRISPR)
KN516477 1 Kit

Sort1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB505314 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Maltopentose
TRC-M160170-5MG 5 mg

Maltopentose

Sign In for Pricing
View Details
Mini Sample Mouse IgA (Immunoglobulin A) ELISA Kit
E-MSEL-M0079-01 24 Tests

Mini Sample Mouse IgA (Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse IgA (Immunoglobulin A) ELISA Kit
E-MSEL-M0079-02 48 Tests

Mini Sample Mouse IgA (Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse IgA (Immunoglobulin A) ELISA Kit
E-MSEL-M0079-03 96 Tests

Mini Sample Mouse IgA (Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details