Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFB1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

TGFB1, Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide, LAP), Transforming growth factor beta-1, TGF-beta-1) ]

Reactivity

Chicken|Gallus gallus

Target

Multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodeling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts. Mediates SMAD2/3 activation by inducing its phosphorylation and subsequent translocation to the nucleus (By similarity) .

Type

Protein

Source

E.coli

Sequence

DLDTDYCFGPGTDEKNCCVRPLYIDFRKDLQWKWIHEPKGYMANFCMGPCPYIWSADTQYTKVLALYNQHNPGASAAPCCVPQTLDPLPIIYYVGRNVRVEQLSNMVVRACKCS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TGFB1

Host or Source

Chicken

Protein Name

Transforming growth factor beta-1

Gene Name URL

TGFB1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCPG1 Human Gene Knockout Kit (CRISPR)
KN423087 1 Kit

CCPG1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human SUSD4 activation kit by CRISPRa
GA110484 1 Kit

Human SUSD4 activation kit by CRISPRa

Sign In for Pricing
View Details
RAB40A Human Gene Knockout Kit (CRISPR)
KN420169 1 Kit

RAB40A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S100B (S100B/1012), CF488A conjugate, 0.1mg/mL
BNC881012-100 1x 100 µL

S100B (S100B/1012), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nestin Recombinant Rabbit Monoclonal Antibody [SN06-27]
ET1611-21 100 µL

Nestin Recombinant Rabbit Monoclonal Antibody [SN06-27]

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2398), CF488A conjugate, 0.1mg/mL
BNC882398-500 1x 500 µL

SOX9 / SRY-box 9 (SOX9/2398), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details