Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFB1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Transforming growth factor beta 1

Gene Aliases

TGF-beta-1; transforming growth factor beta-1; transforming growth factor beta-1 proprotein; transforming growth factor, beta 1 (Camurati-Engelmann disease) .

Gene ID

282089

Accession Number

NP_001159540.1

Reactivity

Bos taurus|Bovine

Target

Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity) . Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP) (By similarity) . Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner. At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development. At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells. Mediates SMAD2/3 activation by inducing its phosphorylation and subsequent translocation to the nucleus. Can induce epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types (By similarity) .

Type

Protein

Source

E.coli

Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TGFB1

Host or Source

Bovine

Protein Name

Transforming growth factor beta-1

Gene Name URL

TGFB1

Nucleotide Accession Number

NM_001166068.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDA6 Rabbit Polyclonal Antibody
BT-AP11813-01 20 µL

PCDA6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCDA6 Rabbit Polyclonal Antibody
BT-AP11813-02 50 µL

PCDA6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCDA6 Rabbit Polyclonal Antibody
BT-AP11813-03 100 µL

PCDA6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Aminoindan-1-ol
sc-274310 200 mg

2-Aminoindan-1-ol

Sign In for Pricing
View Details
L3MBTL3 Rabbit Polyclonal Antibody (Cy3)
orb2585755 100 µg

L3MBTL3 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Muc5b Peptide
orb1236080 0.1 mg

Muc5b Peptide

Sign In for Pricing
View Details