Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

EGF-like TGF, ETGFTGF type 1

Reactivity

Ovis aries|Sheep

Target

TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.

Type

Protein

Source

E.coli

Sequence

ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TGFA

Host or Source

Sheep

Protein Name

Protransforming growth factor alpha

Gene Name URL

TGFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD1 (PDCD1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D1]
TA808035AM 100 µL

PD1 (PDCD1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D1]

Sign In for Pricing
View Details
MART-1 / Melan-A (MLANA/788), 1mg/mL
BNUM0788-50 1x 50 µL

MART-1 / Melan-A (MLANA/788), 1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LASS4 (CERS4) Rabbit Polyclonal Antibody
TA362794 100 µL

LASS4 (CERS4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MT1E Human Gene Knockout Kit (CRISPR)
KN419414 1 Kit

MT1E Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Digital Hotplate, 7x7 inch, 230V
H3770-H-E 1 Each

Digital Hotplate, 7x7 inch, 230V

Sign In for Pricing
View Details