Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TESC Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Tescalcin

Gene Aliases

Calcineurin B homologous protein 3; calcineurin-like EF hand protein 3; CHP3; Tescalcin; TSC.

Gene ID

54997

Accession Number

NP_001161797.1

Reactivity

Homo sapiens|Human

Target

Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na (+) /H (+) exchange activity. Promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane. Promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. Essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. Also involved in granulocytic differentiation in a ERK-dependent manner. Inhibits the phosphatase activity of calcineurin.

Type

Protein

Source

E.coli

Sequence

GAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETMALCH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TESC

Host or Source

Human

Protein Name

Calcineurin B homologous protein 3

Gene Name URL

TESC

Nucleotide Accession Number

NM_001168325.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Muscle tissue
CS704842 5x 5 µm

Tissue FFPE Sections, Muscle tissue

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS701869 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
SNAP23 Recombinant Rabbit Monoclonal Antibody [JA73-15]
ET1704-95 100 µL

SNAP23 Recombinant Rabbit Monoclonal Antibody [JA73-15]

Sign In for Pricing
View Details
Histone H3 (Acetyl-Lys14) Antibody
8D0007-AAT 50 µg

Histone H3 (Acetyl-Lys14) Antibody

Sign In for Pricing
View Details
Biotin Ethylenediamine Iodoacetamide
#90059 1x 25 mg

Biotin Ethylenediamine Iodoacetamide

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Bovine IgG, Fc Specific,  10nm
GAF-512-10 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Bovine IgG, Fc Specific, 10nm

Sign In for Pricing
View Details