Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TESC Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Tescalcin

Gene Aliases

Calcineurin B homologous protein 3; calcineurin-like EF hand protein 3; CHP3; Tescalcin; TSC.

Gene ID

54997

Accession Number

NP_001161797.1

Reactivity

Homo sapiens|Human

Target

Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na (+) /H (+) exchange activity. Promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane. Promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. Essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. Also involved in granulocytic differentiation in a ERK-dependent manner. Inhibits the phosphatase activity of calcineurin.

Type

Protein

Source

E.coli

Sequence

GAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETMALCH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TESC

Host or Source

Human

Protein Name

Calcineurin B homologous protein 3

Gene Name URL

TESC

Nucleotide Accession Number

NM_001168325.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf77 (SMIM24) Human Gene Knockout Kit (CRISPR)
KN427161 1 Kit

C19orf77 (SMIM24) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GDF-5/6/7/16 (A-2) AC
sc-374184 AC 500 µg/mL - 25% ag

GDF-5/6/7/16 (A-2) AC

Sign In for Pricing
View Details
Eppendorf twin.tec Trace PCR Plate 96, skirted, 150 uL, PCR clean, colorless, 25 plates
4030-9768 25 Plates

Eppendorf twin.tec Trace PCR Plate 96, skirted, 150 uL, PCR clean, colorless, 25 plates

Sign In for Pricing
View Details
Anti-ANP NPPA Monoclonal Antibody, Carrier-free
M01318-carrier-free 100 µL

Anti-ANP NPPA Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
P5CS Rabbit pAb
E47R21070 100 µL

P5CS Rabbit pAb

Sign In for Pricing
View Details
Mouse Nms Pre-designed siRNA Set B
SI109437B 1 Each

Mouse Nms Pre-designed siRNA Set B

Sign In for Pricing
View Details