What is the catalog number for SPT15 Recombinant Protein?

The catalog number for SPT15 Recombinant Protein is OPCA01884-20UG.

What sizes are available for SPT15 Recombinant Protein?

SPT15 Recombinant Protein is available in the following size(s): 20 µg.

Is SPT15 Recombinant Protein in stock?

SPT15 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

SPT15 Recombinant Protein

Selected Variant

OPCA01884-20UG

Size: 20 µg

Product Specifications

CAS Number

9000-83-3

Gene Name

TATA-binding protein

Gene Aliases

BTF1; TATA sequence-binding protein; TATA-binding factor; TATA-binding protein; TATA-box factor; TBP1; Transcription factor D; Transcription initiation factor TFIID TBP subunit; YER148W.

Gene ID

856891

Reactivity

Saccharomyces cerevisiae

Target

General transcription factor that functions at the core of the DNA-binding general transcription factor complex TFIID. Binding of TFIID to a promoter (with or without TATA element) is the initial step in preinitiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription.

Type

Protein

Source

E.coli

Sequence

ADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SPT15

Host or Source

Yeast

Protein Name

TATA-box-binding protein

Gene Name URL

SPT15

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain (HP6053), 1mg/mL

BNUM0681-50 1x 50 µL